missing translation for 'onlineSavingsMsg'
Learn More
Learn More
KCNN3 Antibody, Novus Biologicals™
Rabbit Monoclonal Antibody
€ 224.00 - € 530.00
Specifications
| Antigen | KCNN3 |
|---|---|
| Dilution | ELISA Recommended starting concentration is 1 μg/mL, Immunocytochemistry/Immunofluorescence 1:50 - 1:200 |
| Applications | ELISA, Immunocytochemistry/Immunofluorescence |
| Classification | Monoclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
30227712
|
Novus Biologicals
NBP3-33422-100ul |
100 μL |
€ 530.00
100µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
30232352
|
Novus Biologicals
NBP3-33422-20ul |
20 μL |
€ 224.00
20µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
KCNN3 Monoclonal antibody specifically detects KCNN3 in Human samples. It is validated for ELISA,Immunocytochemistry/ImmunofluorescenceSpecifications
| KCNN3 | |
| ELISA, Immunocytochemistry/Immunofluorescence | |
| Unconjugated | |
| Rabbit | |
| Neuroscience, Signal Transduction | |
| PBS (pH 7.3), 50% glycerol, 0.05% BSA | |
| 3782 | |
| IgG | |
| Affinity purified |
| ELISA Recommended starting concentration is 1 μg/mL, Immunocytochemistry/Immunofluorescence 1:50 - 1:200 | |
| Monoclonal | |
| Purified | |
| RUO | |
| Human | |
| hSK3, KCa2.3SKCA3small conductance calcium-activated potassium channel protein 3, potassium intermediate/small conductance calcium-activated channel, subfamilyN, member 3, SK3K3, SKCa 3, SKCa3 | |
| A synthetic peptide corresponding to a sequence within amino acids 630-730 of human KCNN3 (NP_002240.3).,, Sequence:, DLSKMQNVMYDLITELNDRSEDLEKQIGSLESKLEHLTASFNSLPLLIADTLRQQQQQLLSAIIEARGVSVAVGTTHTPISDSPIGVSSTSFPTPYTSSSS | |
| Primary | |
| Store at -20°C. Avoid freeze-thaw cycles. |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title