missing translation for 'onlineSavingsMsg'
Learn More
Learn More
KCTD16 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP2-30652-25ul
This item is not returnable.
View return policy
Description
KCTD16 Polyclonal specifically detects KCTD16 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.
Specifications
| KCTD16 | |
| Polyclonal | |
| Western Blot 0.4 ug/ml, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin 1:50 - 1:200 | |
| Q68DU8 | |
| KCTD16 | |
| This antibody was developed against a recombinant protein corresponding to amino acids: PQETVICGPVTRQTNIQTLDRPIKKGPVQLIQQSEMRRKSDLLRTLTSGSRESNMSSKKKAVKEKLS | |
| 25 μL | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| BTB/POZ domain-containing protein KCTD16, DKFZp781A1155, KIAA1317Potassium channel tetramerization domain-containing protein 16, MGC138167, potassium channel tetramerisation domain containing 16 | |
| Rabbit | |
| Affinity Purified | |
| RUO | |
| 57528 | |
| Human | |
| IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction