missing translation for 'onlineSavingsMsg'
Learn More
Learn More
KIF1A Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP1-80033
Les retours ne sont pas autorisés pour ce produit.
Afficher la politique du retour.
Description
KIF1A Polyclonal specifically detects KIF1A in Human samples. It is validated for Western Blot.
Spécification
| KIF1A | |
| Polyclonal | |
| Unconjugated | |
| PBS, 2% Sucrose with 0.09% Sodium Azide | |
| heavy chain, member 1A, homolog of mouse, kinesin family member 1A, unc-104- and KIF1A-related protein | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| 547 | |
| Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer. | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
| Western Blot | |
| 0.5 mg/ml | |
| Western Blot 1.0 ug/ml | |
| NP_004312 | |
| KIF1A | |
| Synthetic peptide directed towards the N terminal of human KIF1A. Peptide sequence TTIVNPKQPKETPKSFSFDYSYWSHTSPEDINYASQKQVYRDIGEEMLQH. | |
| 100 μL | |
| Primary | |
| Expected identity based on immunogen sequence: Bovine: 100%; Canine: 100%; Guinea pig: 100%; Equine: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Chicken: 92%; Zebrafish: 78%. | |
| Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit, Yeast, Zebrafish | |
| IgG |
Correction du contenu d'un produit
Veuillez fournir vos retours sur le contenu du produit en remplissant le formulaire ci-dessous.
Nom du produit
For Research Use Only
Vous avez repéré une opportunité d'amélioration ?Partager une correction de contenu