missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Kinesin 5A Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
€ 415.00 - € 589.00
Specifications
| Antigen | Kinesin 5A |
|---|---|
| Applications | Immunocytochemistry, Immunofluorescence |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18204513
|
Novus Biologicals
NBP2-57903 |
100 μL |
€ 589.00
100µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18618048
|
Novus Biologicals
NBP2-57903-25ul |
25 μL |
€ 415.00
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
Kinesin 5A Polyclonal specifically detects Kinesin 5A in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.Specifications
| Kinesin 5A | |
| Polyclonal | |
| Rabbit | |
| Cytoskeleton Markers | |
| D12S1889, KIF5A variant protein, kinesin family member 5A, kinesin heavy chain isoform 5A, Kinesin heavy chain neuron-specific 1, kinesin, heavy chain, neuron-specific, MY050, Neuronal kinesin heavy chain, NKHC1, NKHCspastic paraplegia 10 (autosomal dominant), SPG10 | |
| KIF5A | |
| IgG | |
| Affinity Purified |
| Immunocytochemistry, Immunofluorescence | |
| Unconjugated | |
| RUO | |
| Human | |
| 3798 | |
| This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:RLQEVSGHQRKRIAEVLNGLMKDLSEFSVIVGNGEIKLPVEISGAIEEEFT | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title