missing translation for 'onlineSavingsMsg'
Learn More

Kir2.2 Antibody, Novus Biologicals™

Product Code. 30228530 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
20 μL
100 μL
Unit Size:
100µL
20µL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
30228530 100 μL 100µL
30231586 20 μL 20µL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
This item is not returnable. View return policy
Product Code. 30228530 Supplier Novus Biologicals Supplier No. NBP335430100ul

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Rabbit Polyclonal Antibody

Kir2.2 Polyclonal antibody specifically detects Kir2.2 in Mouse,Rat samples. It is validated for ELISA,Western Blot
TRUSTED_SUSTAINABILITY

Specifications

Antigen Kir2.2
Applications ELISA, Western Blot
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 1:500 - 1:2000, ELISA
Formulation PBS (pH 7.3), 50% glycerol
Gene Alias ATP-sensitive inward rectifier potassium channel 12, hIRK, hIRK1, hkir2.2x, Inward rectifier K(+) channel Kir2.2, Inward rectifier K(+) channel Kir2.2v, inward rectifier K(+) channel Kir2.6, IRK2IRK-2, kcnj12x, KCNJN1FLJ14167, Kir2.2, Kir2.2v, Potassium channel, inwardly rectifying subfamily J member 12, potassium inwardly-rectifying channel, subfamily J, inhibitor 1, potassium inwardly-rectifying channel, subfamily J, member 12
Host Species Rabbit
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 354-433 of human Kir2.2 (NP_066292.2).,, Sequence:, TPRCSAKDLVENKFLLPSANSFCYENELAFLSRDEEDEADGDQDGRSRDGLSPQARHDFDRLQAGGGVLEQRPYRRESEI
Purification Method Affinity purified
Quantity 100 μL
Regulatory Status RUO
Research Discipline Signal Transduction
Primary or Secondary Primary
Gene ID (Entrez) 3768
Target Species Mouse, Rat
Content And Storage Store at -20°C. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.