missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Kir2.2 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
€ 190.00 - € 550.00
Specifications
| Antigen | Kir2.2 |
|---|---|
| Dilution | Western Blot 1:500 - 1:2000, ELISA |
| Applications | ELISA, Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
30231586
|
Novus Biologicals
NBP3-35430-20ul |
20 μL |
€ 190.00
20µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
30228530
|
Novus Biologicals
NBP3-35430-100ul |
100 μL |
€ 550.00
100µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
Kir2.2 Polyclonal antibody specifically detects Kir2.2 in Mouse,Rat samples. It is validated for ELISA,Western BlotSpecifications
| Kir2.2 | |
| ELISA, Western Blot | |
| Unconjugated | |
| Rabbit | |
| Signal Transduction | |
| PBS (pH 7.3), 50% glycerol | |
| 3768 | |
| IgG | |
| Affinity purified |
| Western Blot 1:500 - 1:2000, ELISA | |
| Polyclonal | |
| Purified | |
| RUO | |
| Mouse, Rat | |
| ATP-sensitive inward rectifier potassium channel 12, hIRK, hIRK1, hkir2.2x, Inward rectifier K(+) channel Kir2.2, Inward rectifier K(+) channel Kir2.2v, inward rectifier K(+) channel Kir2.6, IRK2IRK-2, kcnj12x, KCNJN1FLJ14167, Kir2.2, Kir2.2v, Potassium channel, inwardly rectifying subfamily J member 12, potassium inwardly-rectifying channel, subfamily J, inhibitor 1, potassium inwardly-rectifying channel, subfamily J, member 12 | |
| Recombinant fusion protein containing a sequence corresponding to amino acids 354-433 of human Kir2.2 (NP_066292.2).,, Sequence:, TPRCSAKDLVENKFLLPSANSFCYENELAFLSRDEEDEADGDQDGRSRDGLSPQARHDFDRLQAGGGVLEQRPYRRESEI | |
| Primary | |
| Store at -20°C. Avoid freeze-thaw cycles. |
Vous avez repéré une opportunité d'amélioration ?Partager une correction de contenu
Correction du contenu d'un produit
Veuillez fournir vos retours sur le contenu du produit en remplissant le formulaire ci-dessous.
Nom du produit