missing translation for 'onlineSavingsMsg'
Learn More
Learn More
KLF8 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody has been used in 1 publication
€ 415.00 - € 624.00
Specifications
| Antigen | KLF8 |
|---|---|
| Applications | Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18208042
|
Novus Biologicals
NBP2-57740 |
100 μL |
€ 624.00
100µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18667187
|
Novus Biologicals
NBP2-57740-25ul |
25 μL |
€ 415.00
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
KLF8 Polyclonal specifically detects KLF8 in Human, Mouse samples. It is validated for Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.Specifications
| KLF8 | |
| Polyclonal | |
| Rabbit | |
| Human, Mouse | |
| 11279 | |
| This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:PALFNDIKIEPPEELLASDFSLPQVEPVDLSFHKPKAPLQPASMLQAPIRPPKPQSSPQ | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| RUO | |
| Basic krueppel-like factor 3, basic kruppel-like factor 3, BKLF3DKFZp686O08126, DXS741, Krueppel-like factor 8, Kruppel-like factor 8, Zinc finger protein 741, ZNF741MGC138314 | |
| KLF8 | |
| IgG | |
| Affinity Purified |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title