missing translation for 'onlineSavingsMsg'
Learn More
Learn More
KLHDC10 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody has been used in 1 publication
€ 292.00 - € 540.75
Specifications
| Antigen | KLHDC10 |
|---|---|
| Dilution | Western Blot 0.4 ug/ml, Immunohistochemistry 1:10-1:500, Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml, Immunohistochemistry-Paraffin 1:50-1:200 |
| Applications | Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18468520
|
Novus Biologicals
NBP1-81528-25ul |
25 μL |
€ 292.00
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18205778
|
Novus Biologicals
NBP1-81528 |
0.1 mL |
€ 572.00 € 540.75 / 0.10mL Save € 31.25 5% Off |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
KLHDC10 Polyclonal specifically detects KLHDC10 in Human, Rat samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.Specifications
| KLHDC10 | |
| Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| RUO | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| 23008 | |
| This antibody was developed against Recombinant Protein corresponding to amino acids:EWTQLKPNNLSCDLPEERYRHEIAHDGQRIYILGGGTSWTAYSLNKIHAYNLETNAWEEIATKPHEKIGFPAARRCHSCVQIK | |
| Primary | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Western Blot 0.4 ug/ml, Immunohistochemistry 1:10-1:500, Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml, Immunohistochemistry-Paraffin 1:50-1:200 | |
| Polyclonal | |
| Rabbit | |
| Human, Rat | |
| kelch domain containing 10, KIAA0265kelch domain-containing protein 10, PNAS-119, scruin like at the midline homolog, slim | |
| KLHDC10 | |
| IgG | |
| Affinity Purified | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title