missing translation for 'onlineSavingsMsg'
Learn More
Learn More
KLHL24 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP2-37705
This item is not returnable.
View return policy
Description
KLHL24 Polyclonal specifically detects KLHL24 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.
Specifications
| KLHL24 | |
| Polyclonal | |
| Immunohistochemistry 1:50 - 1:200, Immunohistochemistry-Paraffin 1:10000 - 1:20000 | |
| Q6TFL4 | |
| KLHL24 | |
| This antibody was developed against a recombinant protein corresponding to amino acids: MVLILGRRLNREDLGVRDSPATKRKVFEMDPKSLTGHEFFDFSSGSSHAENILQIFNEFRDSRLFTDVIICVEG | |
| 0.1 mL | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| DRE1, Kainate Receptor Interacting Protein For GluR6, Kainate Receptor-Interacting Protein For GluR6, Kelch-Like 24, Kelch-Like 24 (Drosophila), Kelch-Like Family Member 24, Kelch-Like Protein 24, KLHL24 KRIP6, Protein DRE1 | |
| Rabbit | |
| Affinity Purified | |
| RUO | |
| 54800 | |
| Human | |
| IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction