missing translation for 'onlineSavingsMsg'
Learn More
Learn More
KPNA5 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
€ 483.00
Specifications
| Antigen | KPNA5 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
KPNA5 Polyclonal specifically detects KPNA5 in Human samples. It is validated for Western Blot.Specifications
| KPNA5 | |
| Polyclonal | |
| Rabbit | |
| importin alpha 6, importin subunit alpha-6, IPOA6, karyopherin alpha 5 (importin alpha 6), Karyopherin subunit alpha-5, SRP6 | |
| KPNA5 | |
| IgG | |
| This product is specific to Subunit or Isoform: alpha-6. |
| Western Blot | |
| Unconjugated | |
| RUO | |
| 3841 | |
| Synthetic peptides corresponding to KPNA5(karyopherin alpha 5 (importin alpha 6)) The peptide sequence was selected from the C terminal of KPNA5. Peptide sequence TVMDSKIVQVALNGLENILRLGEQESKQNGIGINPYCALIEEAYGLDKIE. | |
| Primary | |
| 61 kDa |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title