missing translation for 'onlineSavingsMsg'
Learn More
Learn More
KRAS Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
€ 302.00 - € 549.00
Specifications
| Antigen | KRAS |
|---|---|
| Dilution | Immunohistochemistry, Immunohistochemistry-Paraffin 1:20 - 1:50 |
| Applications | Immunohistochemistry, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18488241
|
Novus Biologicals
NBP2-33579-25ul |
25 μL |
€ 302.00
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18787913
|
Novus Biologicals
NBP2-33579 |
0.1 mL |
€ 549.00
0.10mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
KRAS Polyclonal specifically detects KRAS in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
| KRAS | |
| Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| RUO | |
| Human | |
| P01116 | |
| 3845 | |
| This antibody was developed against a recombinant protein corresponding to amino acids: EGFLCVFAINNTKSFEDIHHYREQIKRVKDSEDV | |
| Primary | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Immunohistochemistry, Immunohistochemistry-Paraffin 1:20 - 1:50 | |
| Polyclonal | |
| Rabbit | |
| Cell Cycle and Replication, Core ESC Like Genes, mTOR Pathway, Stem Cell Markers | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| cellular c-Ki-ras2 proto-oncogene, c-Ki-ras, C-K-RAS, GTPase KRas, Ki-Ras, Kirsten rat sarcoma-2 viral (v-Ki-ras2) oncogene homolog, K-Ras 2, K-ras p21 protein, KRAS1, K-RAS2A, K-RAS2B, KRAS2NS3, K-RAS4A, K-RAS4B, NS, oncogene KRAS2, PR310 c-K-ras oncogene, RASK2c-Kirsten-ras protein, transforming protein p21, v-Ki-ras2 Kirsten rat sarcoma 2 viral oncogene homolog, v-Ki-ras2 Kirsten rat sarcoma viral oncogene homolog | |
| KRAS | |
| IgG | |
| Affinity Purified | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title