Learn More
Invitrogen™ KRIT1 Polyclonal Antibody

Rabbit Polyclonal Antibody
Brand: Invitrogen™ PA595383
Description
Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 μg/mL. Positive Control - WB: rat cardiac muscle tissue, NIH3T3 whole cell, HELA whole cell. Store at -20°C for one year from date of receipt. After reconstitution, at 4°C for one month. It can also be aliquotted and stored frozen at -20°C for six months. Avoid repeated freeze-thaw cycles.
This gene encodes a protein containing four ankyrin repeats, a band 4.1/ezrin/radixin/moesin (FERM) domain, and multiple NPXY sequences. The encoded protein is localized in the nucleus and cytoplasm. It binds to integrin cytoplasmic domain-associated protein-1 alpha (ICAP1alpha), and plays a critical role in beta1-integrin-mediated cell proliferation. It associates with junction proteins and RAS-related protein 1A (Rap1A), which requires the encoded protein for maintaining the integrity of endothelial junctions. It is also a microtubule-associated protein and may play a role in microtubule targeting. Mutations in this gene result in cerebral cavernous malformations. Multiple alternatively spliced transcript variants have been found for this gene.
Specifications
| KRIT1 | |
| Polyclonal | |
| Unconjugated | |
| KRIT1 | |
| 2010007K12Rik; A630036P20Rik; AA432855; AI450393; AI643869; ankyrin repeat-containing protein Krit1; BB155247; BB235701; CAM; Ccm1; Cerebral cavernous malformations 1 protein; cerebral cavernous malformations 1 protein homolog; Krev interaction trapped 1; krev interaction trapped protein 1; KRIT1; KRIT1, ankyrin repeat containing; RGD1305929 | |
| Rabbit | |
| Affinity chromatography | |
| RUO | |
| 362317, 79264, 889 | |
| -20°C | |
| Lyophilized |
| Western Blot | |
| 500 μg/mL | |
| PBS with 5mg BSA and 0.05mg sodium azide | |
| O00522, Q6S5J6 | |
| KRIT1 | |
| A synthetic peptide corresponding to a sequence at the C-terminus of human KRIT1 (703-736aa ENKMSFIVHTKQAGLVVKLLMKLNGQLMPTERNS). | |
| 100 μg | |
| Primary | |
| Human, Mouse, Rat | |
| Antibody | |
| IgG |
Your input is important to us. Please complete this form to provide feedback related to the content on this product.