missing translation for 'onlineSavingsMsg'
Learn More
Learn More
KxDL motif containing 1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
€ 433.00 - € 624.00
Specifications
| Antigen | KxDL motif containing 1 |
|---|---|
| Dilution | Western Blot 0.4 ug/ml, Immunohistochemistry 1:50 - 1:200, Immunohistochemistry-Paraffin 1:50 - 1:200 |
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18482321
|
Novus Biologicals
NBP1-82055-25ul |
25 μL |
€ 433.00
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18218745
|
Novus Biologicals
NBP1-82055 |
0.1 mL |
€ 624.00
0.10mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
KxDL motif containing 1 Polyclonal specifically detects KxDL motif containing 1 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
| KxDL motif containing 1 | |
| Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| RUO | |
| Human | |
| C19orf50, chromosome 19 open reading frame 50, DKFZp686B1038, FLJ25480, FLJ43375, hypothetical protein LOC79036, KXD1, KXDL, KxDL motif containing 1, MGC2749, MST096, MSTP096 | |
| KXD1 | |
| IgG | |
| Affinity Purified | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| Western Blot 0.4 ug/ml, Immunohistochemistry 1:50 - 1:200, Immunohistochemistry-Paraffin 1:50 - 1:200 | |
| Polyclonal | |
| Rabbit | |
| Signal Transduction | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| 79036 | |
| This antibody was developed against Recombinant Protein corresponding to amino acids:ILSMVNTDDVNAIILAQKNMLDRFEKTNEMLLNFNNLSSARLQQMSERFLHHTRTLVEMKRDLDSIFRRIRTLKGKLA | |
| Primary | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title