missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Lano Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
€ 415.00 - € 572.00
Specifications
| Antigen | Lano |
|---|---|
| Dilution | Western Blot 0.04-0.4 ug/mL, Immunocytochemistry/ Immunofluorescence 0.25-2 ug/mL |
| Applications | Western Blot, Immunocytochemistry |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18431182
|
Novus Biologicals
NBP1-88015-25ul |
25 μL |
€ 415.00
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18498071
|
Novus Biologicals
NBP1-88015 |
0.1 mL |
€ 572.00
0.10mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
Lano Polyclonal antibody specifically detects Lano in Human samples. It is validated for Western Blot, Immunocytochemistry/ ImmunofluorescenceSpecifications
| Lano | |
| Western Blot, Immunocytochemistry | |
| Unconjugated | |
| Rabbit | |
| Cytokines and Growth Factors, Immunology, Neuroscience | |
| PBS (pH 7.2) and 40% Glycerol | |
| 55227 | |
| IgG | |
| Immunogen affinity purified |
| Western Blot 0.04-0.4 ug/mL, Immunocytochemistry/ Immunofluorescence 0.25-2 ug/mL | |
| Polyclonal | |
| Purified | |
| RUO | |
| Human | |
| dJ523E19.1, FLJ10775, FLJ11834, LANOLANO adapter protein, LAP (leucine-rich repeats and PDZ) and no PDZ protein, LAP and no PDZ protein, leucine rich repeat containing 1, leucine-rich repeat-containing 1, leucine-rich repeat-containing protein 1 | |
| This antibody was developed against Recombinant Protein corresponding to amino acids: QSLPENIGNLYNLASLELRENLLTYLPDSLTQLRRLEELDLGNNEIYNLPESVGALLHLKDLWLDGNQLSELPQEIGNLKNLLCL | |
| Primary | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Vous avez repéré une opportunité d'amélioration ?Partager une correction de contenu
Correction du contenu d'un produit
Veuillez fournir vos retours sur le contenu du produit en remplissant le formulaire ci-dessous.
Nom du produit