missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Leptin/OB Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP1-59320
This item is not returnable.
View return policy
Description
Leptin/OB Polyclonal antibody specifically detects Leptin/OB in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
Specifications
| Leptin/OB | |
| Polyclonal | |
| Unconjugated | |
| PBS, 2% Sucrose | |
| FLJ94114, leptin, leptin (murine obesity homolog), leptin (obesity homolog, mouse), Obese protein, obese, mouse, homolog of, Obesity factor, OBOBS | |
| Synthetic peptides corresponding to LEP(leptin) The peptide sequence was selected form the N terminal of LEP. Peptide sequence MHWGTLCGFLWLWPYLFYVQAVPIQKVQDDTKTLIKTIVTRINDISHTQS. The peptide sequence for this immunogen was taken from within the described region. | |
| 100 μg | |
| Cytokine Research, Diabetes Research, Immunology, Lipid and Metabolism | |
| 3952 | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. | |
| IgG |
| Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| 0.5 mg/mL | |
| Western Blot 1.0 μg/mL, Immunohistochemistry 1:10-1:500, Immunohistochemistry-Paraffin 4-8μg/mL | |
| P41159 | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| Primary | |
| Human | |
| Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction