missing translation for 'onlineSavingsMsg'
Learn More

Leukotriene B4 R1 Antibody, Novus Biologicals™

Product Code. 18219746 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
25 μL
0.1 mL
Unit Size:
0.10mL
25µL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
18219746 0.1 mL 0.10mL
18444062 25 μL 25µL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
This item is not returnable. View return policy
Product Code. 18219746 Supplier Novus Biologicals Supplier No. NBP189959

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Rabbit Polyclonal Antibody has been used in 1 publication

Leukotriene B4 R1 Polyclonal specifically detects Leukotriene B4 R1 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.
TRUSTED_SUSTAINABILITY

Specifications

Antigen Leukotriene B4 R1
Applications Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 0.4 ug/ml, Immunohistochemistry, Immunohistochemistry-Paraffin 1:50 - 1:200
Formulation PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Alias chemokine receptor-like 1, CMKRL1, leukotriene B4 receptor, LTBR1, P2Y purinoceptor 7, purinergic receptor P2Y, G-protein coupled, 7
Gene Symbols LTB4R
Host Species Rabbit
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:GVGFVAKLLEGTGSEASSTRRGGSLGQTARSGPAALEPGPSESLTASSPLKLNE
Purification Method Affinity Purified
Quantity 0.1 mL
Regulatory Status RUO
Research Discipline GPCR, Immunology, Innate Immunity, Signal Transduction
Primary or Secondary Primary
Gene ID (Entrez) 1241
Test Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Target Species Human
Content And Storage Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less

For Research Use Only

Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.