missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Leukotriene B4 Receptor 2 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
€ 415.00 - € 588.00
Specifications
| Antigen | Leukotriene B4 Receptor 2 |
|---|---|
| Dilution | Immunohistochemistry, Immunohistochemistry-Paraffin 1:50 - 1:200 |
| Applications | Immunohistochemistry, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18460522
|
Novus Biologicals
NBP1-89960-25ul |
25 μL |
€ 415.00
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18086104
|
Novus Biologicals
NBP1-89960 |
0.1 mL |
€ 588.00
0.10mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
Leukotriene B4 Receptor 2 Polyclonal specifically detects Leukotriene B4 Receptor 2 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
| Leukotriene B4 Receptor 2 | |
| Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| RUO | |
| Human | |
| BLT2LTB4 receptor JULF2, BLT2R, BLTR2LTB4-R2, JULF2, KPG_004, leukotriene B4 receptor 2, Leukotriene B4 receptor BLT2, LTB4-R 2, NOP9, Seven transmembrane receptor BLTR2 | |
| LTB4R2 | |
| IgG | |
| Affinity Purified | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| Immunohistochemistry, Immunohistochemistry-Paraffin 1:50 - 1:200 | |
| Polyclonal | |
| Rabbit | |
| GPCR, Immunology, Innate Immunity | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| 56413 | |
| This antibody was developed against Recombinant Protein corresponding to amino acids:MAPSHRASQVGFCPTPERPLWRLPPTCRPRRMSVCYRPPGNETLLSWKTSR | |
| Primary | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title