missing translation for 'onlineSavingsMsg'
Learn More
Learn More
LRCH4 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP1-81288
This item is not returnable.
View return policy
Description
LRCH4 Polyclonal antibody specifically detects LRCH4 in Human samples. It is validated for Immunohistochemistry, Immunocytochemistry/ Immunofluorescence, Immunohistochemistry (Paraffin)
Specifications
| LRCH4 | |
| Polyclonal | |
| Immunohistochemistry 1:20 - 1:50, Immunocytochemistry/ Immunofluorescence 0.25-2 ug/mL, Immunohistochemistry-Paraffin 1:20 - 1:50 | |
| FLJ40101, FLJ46315, leucine rich repeat neuronal 4, Leucine-rich neuronal protein, leucine-rich repeat and calponin homology domain-containing protein 4, Leucine-rich repeat neuronal protein 4, leucine-rich repeats and calponin homology (CH) domain containing 4, LRN, LRRN1, LRRN4, PP14183 | |
| This antibody was developed against Recombinant Protein corresponding to amino acids: LPIAGPATAPAPRPLGSIQRPNSFLFRSSSQSGSGPSSPDSVLRPRRYPQVPDEKDLMTQLRQVLESRLQ | |
| 0.1 mL | |
| Primary | |
| Human | |
| Purified |
| Immunohistochemistry, Immunocytochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| PBS (pH 7.2) and 40% Glycerol | |
| Rabbit | |
| Immunogen affinity purified | |
| RUO | |
| 4034 | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. | |
| IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction