missing translation for 'onlineSavingsMsg'
Learn More
Learn More
LRRC46 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
€ 433.00 - € 725.00
Specifications
| Antigen | LRRC46 |
|---|---|
| Dilution | Western Blot 0.04-0.4 ug/mL, Immunocytochemistry/ Immunofluorescence 0.25-2 ug/mL |
| Applications | Western Blot, Immunocytochemistry |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18439230
|
Novus Biologicals
NBP1-81189 |
0.1 mL |
€ 725.00
0.10mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18427630
|
Novus Biologicals
NBP1-81189-25ul |
25 μL |
€ 433.00
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
LRRC46 Polyclonal antibody specifically detects LRRC46 in Human samples. It is validated for Western Blot, Immunocytochemistry/ ImmunofluorescenceSpecifications
| LRRC46 | |
| Western Blot, Immunocytochemistry | |
| Unconjugated | |
| Rabbit | |
| Human | |
| FLJ23553, leucine rich repeat containing 46, leucine-rich repeat-containing protein 46, MGC16309 | |
| This antibody was developed against Recombinant Protein corresponding to amino acids:PTLTDLPLLPGVPMAGDSSPSATPAQGEETVPEAVSSPQASSPTKKPCSLIPRGHQSSFWGRKGARAATAPKASVAEAPSTTKTT | |
| Primary | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Western Blot 0.04-0.4 ug/mL, Immunocytochemistry/ Immunofluorescence 0.25-2 ug/mL | |
| Polyclonal | |
| Purified | |
| RUO | |
| PBS (pH 7.2) and 40% Glycerol | |
| 90506 | |
| IgG | |
| Immunogen affinity purified |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title