missing translation for 'onlineSavingsMsg'
Learn More
Learn More
LRWD1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
€ 190.00 - € 550.00
Tekniske data
| Antigen | LRWD1 |
|---|---|
| Dilution | Western Blot 1:500 - 1:2000, ELISA |
| Applications | ELISA, Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Produktkode | Brand | Quantity | Pris | Mængde & tilgængelighed | |||||
|---|---|---|---|---|---|---|---|---|---|
| Produktkode | Brand | Quantity | Pris | Mængde & tilgængelighed | |||||
|
30229978
|
Novus Biologicals
NBP3-37930-100ul |
100 μL |
€ 550.00
100µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
30231888
|
Novus Biologicals
NBP3-37930-20ul |
20 μL |
€ 190.00
20µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Beskrivelse
LRWD1 Polyclonal antibody specifically detects LRWD1 in Human samples. It is validated for ELISA,Western BlotTekniske data
| LRWD1 | |
| ELISA, Western Blot | |
| Unconjugated | |
| Rabbit | |
| Cell Biology | |
| PBS (pH 7.3), 50% glycerol | |
| 222229 | |
| IgG | |
| Affinity purified |
| Western Blot 1:500 - 1:2000, ELISA | |
| Polyclonal | |
| Purified | |
| RUO | |
| Human | |
| DKFZp434K1815, leucine-rich repeats and WD repeat domain containing 1, ORCAleucine-rich repeat and WD repeat-containing protein 1, ORC-associated protein, origin recognition complex associated, Origin recognition complex-associated protein | |
| A synthetic peptide corresponding to a sequence within amino acids 250-350 of human LRWD1 (NP_690852.1).,, Sequence:, ASPSAQVEGSPVAGSDGSQPAVKLEPLHFLQCHSKNNSPQDLETQLWACAFEPAWEEGATSQTVATCGGEAVCVIDCQTGIVLHKYKAPGEEFFSVAWTAL | |
| Primary | |
| Store at -20°C. Avoid freeze-thaw cycles. |
Ser du en mulighed for forbedring?Del en indholdskorrektion
Korrektion af produktindhold
Dit input er vigtigt for os. Udfyld denne formular for at give feedback relateret til indholdet på dette produkt.
Produkttitel