missing translation for 'onlineSavingsMsg'
Learn More
Learn More
LRWD1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Marca: Novus Biologicals NBP1-85113
Este artículo no se puede devolver.
Vea la política de devoluciones
Descripción
LRWD1 Polyclonal specifically detects LRWD1 in Human samples. It is validated for Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.
Especificaciones
| LRWD1 | |
| Polyclonal | |
| Immunohistochemistry, Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml, Immunohistochemistry-Paraffin 1:50-1:200 | |
| DKFZp434K1815, leucine-rich repeats and WD repeat domain containing 1, ORCAleucine-rich repeat and WD repeat-containing protein 1, ORC-associated protein, origin recognition complex associated, Origin recognition complex-associated protein | |
| Rabbit | |
| Affinity Purified | |
| RUO | |
| 222229 | |
| Human | |
| IgG |
| Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| LRWD1 | |
| This antibody was developed against Recombinant Protein corresponding to amino acids:PFLTVNDNLKVSFLLPTLRKVNGKDASSTYSQVENLNRELTSRVTAHWEKFMATLGPEEEAEKAQADFVKSAVRD | |
| 0.1 mL | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Corrección del contenido de un producto
Proporcione sus comentarios sobre el contenido del producto rellenando el siguiente formulario.
Título del producto
For Research Use Only
¿Detecta una oportunidad de mejora?Comparta una corrección de contenido