missing translation for 'onlineSavingsMsg'
Learn More

LSM2 Antibody [Alexa Fluor« 405], Novus Biologicals Biologicals™

Product Code. 30514478 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
0.1 mL
Unit Size:
0.1mL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
30514478 0.1 mL 0.1mL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Product Code. 30514478 Supplier Novus Biologicals Supplier No. NBP338492AF405

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Rabbit Polyclonal Antibody

LSM2 Polyclonal antibody specifically detects LSM2 in Human samples. It is validated for ELISA,Western Blot
TRUSTED_SUSTAINABILITY

Specifications

Antigen LSM2
Applications ELISA, Western Blot
Classification Polyclonal
Conjugate Alexa Fluor 405
Formulation 50mM Sodium Borate
Gene Alias C6orf28chromosome 6 open reading frame 28, G7b, LSM2 homolog, U6 small nuclear RNA associated (S. cerevisiae), Protein G7b, Small nuclear ribonuclear protein D homolog, snRNP, snRNP core Sm-like protein Sm-x5, U6 snRNA-associated Sm-like protein LSm2, YBL026W
Host Species Rabbit
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-95 of human LSM2 (NP_067000.1).,, Sequence:, MLFYSFFKSLVGKDVVVELKNDLSICGTLHSVDQYLNIKLTDISVTDPEKYPHMLSVKNCFIRGSVVRYVQLPADEVDTQLLQDAARKEALQQKQ
Purification Method Affinity purified
Quantity 0.1 mL
Regulatory Status RUO
Research Discipline Core ESC Like Genes, Stem Cell Markers
Primary or Secondary Primary
Gene ID (Entrez) 57819
Target Species Human
Content And Storage Store at 4°C in the dark.
Product Type Antibody
Form Purified
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.