missing translation for 'onlineSavingsMsg'
Learn More
Learn More
LSM2 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
€ 190.00 - € 550.00
Specifications
| Antigen | LSM2 |
|---|---|
| Dilution | Western Blot 1:500 - 1:2000, ELISA |
| Applications | ELISA, Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
30230037
|
Novus Biologicals
NBP3-38492-100ul |
100 μL |
€ 550.00
100µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
30226909
|
Novus Biologicals
NBP3-38492-20ul |
20 μL |
€ 190.00
20µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
LSM2 Polyclonal antibody specifically detects LSM2 in Human samples. It is validated for ELISA,Western BlotSpecifications
| LSM2 | |
| ELISA, Western Blot | |
| Unconjugated | |
| Rabbit | |
| Core ESC Like Genes, Stem Cell Markers | |
| PBS (pH 7.3), 50% glycerol | |
| 57819 | |
| IgG | |
| Affinity purified |
| Western Blot 1:500 - 1:2000, ELISA | |
| Polyclonal | |
| Purified | |
| RUO | |
| Human | |
| C6orf28chromosome 6 open reading frame 28, G7b, LSM2 homolog, U6 small nuclear RNA associated (S. cerevisiae), Protein G7b, Small nuclear ribonuclear protein D homolog, snRNP, snRNP core Sm-like protein Sm-x5, U6 snRNA-associated Sm-like protein LSm2, YBL026W | |
| Recombinant fusion protein containing a sequence corresponding to amino acids 1-95 of human LSM2 (NP_067000.1).,, Sequence:, MLFYSFFKSLVGKDVVVELKNDLSICGTLHSVDQYLNIKLTDISVTDPEKYPHMLSVKNCFIRGSVVRYVQLPADEVDTQLLQDAARKEALQQKQ | |
| Primary | |
| Store at -20°C. Avoid freeze-thaw cycles. |
Ser du en mulighed for forbedring?Del en indholdskorrektion
Korrektion af produktindhold
Dit input er vigtigt for os. Udfyld denne formular for at give feedback relateret til indholdet på dette produkt.
Produkttitel