missing translation for 'onlineSavingsMsg'
Learn More
Learn More
LXR alpha/NR1H3 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP1-92086-25ul
This item is not returnable.
View return policy
Description
LXR alpha/NR1H3 Polyclonal specifically detects LXR alpha/NR1H3 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.
Specifications
| LXR alpha/NR1H3 | |
| Polyclonal | |
| Western Blot 0.4 μg/mL, Immunohistochemistry, Immunohistochemistry-Paraffin 1:10-1:20 | |
| alpha, Liver X receptor alpha, liver X receptor-alpha, LXRA, Nuclear receptor subfamily 1 group H member 3, nuclear receptor subfamily 1, group H, member 3, oxysterols receptor LXR-alpha, RLD-1 | |
| Rabbit | |
| Affinity Purified | |
| RUO | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
| Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| NR1H3 | |
| This antibody was developed against Recombinant Protein corresponding to amino acids:MSLWLGAPVPDIPPDSAVELWKPGAQDASSQAQGGSSCILREEARMPHSAGGTAGVGLEAAEPTALLTRAEPPSEPTEIRPQKRK | |
| 25 μL | |
| Diabetes Research, Lipid and Metabolism | |
| 10062 | |
| Human | |
| IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction