missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Lysine (K)-specific Demethylase 6B/KDM6B/JMJD3 Antibody - Azide and BSA Free, Novus Biologicals™
Rabbit Polyclonal Antibody
€ 193.00 - € 470.00
Specifications
| Antigen | Lysine (K)-specific Demethylase 6B/KDM6B/JMJD3 |
|---|---|
| Dilution | Western Blot 1:500-1:2000, Immunocytochemistry/ Immunofluorescence 1:50-1:200 |
| Applications | Western Blot, Immunofluorescence |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18676160
|
Novus Biologicals
NBP2-92982-0.02ml |
0.02 mL |
€ 193.00
0.02mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18606691
|
Novus Biologicals
NBP2-92982-0.1ml |
0.1 mL |
€ 470.00
0.01mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
Lysine (K)-specific Demethylase 6B/KDM6B/JMJD3 Polyclonal antibody specifically detects Lysine (K)-specific Demethylase 6B/KDM6B/JMJD3 in Human, Mouse samples. It is validated for Western Blot, Immunocytochemistry/ ImmunofluorescenceSpecifications
| Lysine (K)-specific Demethylase 6B/KDM6B/JMJD3 | |
| Western Blot, Immunofluorescence | |
| Unconjugated | |
| Rabbit | |
| Cancer, Chromatin Research, Transcription Factors and Regulators | |
| PBS with 50% glycerol, pH7.3. | |
| 23135 | |
| IgG | |
| Affinity purified |
| Western Blot 1:500-1:2000, Immunocytochemistry/ Immunofluorescence 1:50-1:200 | |
| Polyclonal | |
| Purified | |
| RUO | |
| Human, Mouse | |
| EC 1.14.11, EC 1.14.11.-, JmjC domain-containing protein 3, JMJD3lysine-specific demethylase 6B, jumonji domain containing 3, histone lysine demethylase, Jumonji domain-containing protein 3, KIAA0346jumonji domain containing 3, lysine (K)-specific demethylase 6B, Lysine demethylase 6B | |
| Recombinant fusion protein containing a sequence corresponding to amino acids 90-190 of mouse Lysine (K)-specific Demethylase 6B/KDM6B/JMJD3 (NP_001017426.1). LESLHGCVQALLREPAQPGLWEQLGQLYESEHDSEEAVCCYHRALRYGGSFAELGPRIGRLQQAQLWNFHAGSCQHRAKVLPPLEQVWNLLHLEHKRNYGA | |
| Primary | |
| Store at -20°C. Avoid freeze-thaw cycles. |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title