missing translation for 'onlineSavingsMsg'
Learn More
Learn More
GCAP2 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP2-68721
This item is not returnable.
View return policy
Description
GCAP2 Polyclonal antibody specifically detects GCAP2 in Human, Monkey samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin), Immunohistochemistry (Frozen)
Specifications
| GCAP2 | |
| Polyclonal | |
| Western Blot 0.04-0.4 μg/ml, Immunohistochemistry 1:1000 - 1:2500, Immunohistochemistry-Paraffin 1:1000 - 1:2500, Immunohistochemistry-Frozen -Reported in scientific literature (PMID:35024589) | |
| DKFZp686E1183, GCAP 2, GCAP2guanylate cyclase-activating protein, photoreceptor 2, Guanylate cyclase activator 1B, guanylate cyclase activator 1B (retina), guanylyl cyclase-activating protein 2, GUCA2, RP48 | |
| This antibody was developed against a recombinant protein corresponding to amino acids: GQEFSWEEAEAAGEIDVAELQEWYKKFVMECPSGTLFMHEFKRFFKVTDDEEASQYVEGMFRAFDKNG | |
| 100 μg | |
| Signal Transduction, Vision | |
| 2979 | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. | |
| IgG |
| Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin), Immunohistochemistry (Frozen) | |
| Unconjugated | |
| PBS (pH 7.2) and 40% Glycerol | |
| Rabbit | |
| Protein A purified | |
| RUO | |
| Primary | |
| Human, Monkey | |
| Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction