missing translation for 'onlineSavingsMsg'
Learn More
Learn More
MACC1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody has been used in 2 publications
€ 320.00 - € 572.00
Specifications
| Antigen | MACC1 |
|---|---|
| Concentration | 0.1mg/mL |
| Dilution | Simple Western 1:20, Immunohistochemistry, Immunohistochemistry-Paraffin 1:50-1:200 |
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18495741
|
Novus Biologicals
NBP1-89352-25ul |
25 μL |
€ 320.00
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18296296
|
Novus Biologicals
NBP1-89352 |
0.1 mL |
€ 572.00
0.10mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
MACC1 Polyclonal specifically detects MACC1 in Human samples. It is validated for Simple Western, Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
| MACC1 | |
| Simple Western 1:20, Immunohistochemistry, Immunohistochemistry-Paraffin 1:50-1:200 | |
| Polyclonal | |
| Rabbit | |
| Human | |
| metastasis associated in colon cancer 1, SH3 domain-containing protein 7a5,7A5 | |
| MACC1 | |
| IgG | |
| Affinity Purified | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| 0.1mg/mL | |
| Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| RUO | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| 346389 | |
| This antibody was developed against Recombinant Protein corresponding to amino acids:FRSGRIAQSMSEANLIDMEAGKLSKSCNITECQDPDLLHNWPDAFTLRGNNASKVANPFWNQLSASNPF | |
| Primary | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title