missing translation for 'onlineSavingsMsg'
Learn More
Learn More
MAIP1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP1-57840
This item is not returnable.
View return policy
Description
MAIP1 Polyclonal specifically detects MAIP1 in Human samples. It is validated for Western Blot.
Specifications
| C2orf47 | |
| Polyclonal | |
| Unconjugated | |
| PBS, 2% Sucrose with 0.09% Sodium Azide | |
| chromosome 2 open reading frame 47, DKFZp666A212, FLJ22555, hypothetical protein LOC79568 | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| Primary | |
| Expected identity based on immunogen sequence: Canine: 100%; Equine: 100%; Rabbit: 100%; Chicken: 78%. | |
| Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit, Zebrafish | |
| IgG |
| Western Blot | |
| 0.5 mg/ml | |
| Western Blot 1.0 ug/ml | |
| Q8WWC4 | |
| MAIP1 | |
| Synthetic peptides corresponding to C2ORF47 The peptide sequence was selected from the middle region of C2ORF47. Peptide sequence GASVFQVKLGNQNVETKQLLSASYEFQREFTQGVKPDWTIARIEHSKLLE. | |
| 100 μL | |
| Core ESC Like Genes, Stem Cell Markers | |
| 79568 | |
| Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer. | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction