missing translation for 'onlineSavingsMsg'
Learn More
Learn More
MARCH6 Antibody - Azide and BSA Free, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP2-92292-0.1ml
This item is not returnable.
View return policy
Description
MARCH6 Polyclonal antibody specifically detects MARCH6 in Mouse, Rat samples. It is validated for Western Blot
Specifications
| MARCH6 | |
| Polyclonal | |
| Western Blot 1:500-1:2000 | |
| E3 ubiquitin-protein ligase MARCH6, EC 6.3.2.-, MARCH-VIDOA10, membrane-associated ring finger (C3HC4) 6, Membrane-associated RING finger protein 6, Membrane-associated RING-CH protein VI, Protein TEB-4, RNF176KIAA0597Doa10 homolog, TEB4RING finger protein 176 | |
| Recombinant fusion protein containing a sequence corresponding to amino acids 10-80 of human MARCH6 (NP_005876.2). RVCRSEGTPEKPLYHPCVCTGSIKFIHQECLVQWLKHSRKEYCELCKHRFAFTPIYSPDMPSRLPIQDIFA | |
| 0.1 mL | |
| Zinc Finger | |
| 10299 | |
| Store at -20°C. Avoid freeze-thaw cycles. | |
| IgG |
| Western Blot | |
| Unconjugated | |
| PBS with 50% glycerol, pH7.3. | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| Primary | |
| Mouse, Rat | |
| Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction