missing translation for 'onlineSavingsMsg'
Learn More
Learn More
MAST205 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP1-87899-25ul
This item is not returnable.
View return policy
Description
MAST205 Polyclonal antibody specifically detects MAST205 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
Specifications
| MAST205 | |
| Polyclonal | |
| Western Blot 0.04-0.4 ug/mL, Immunohistochemistry 1:20 - 1:50, Immunohistochemistry-Paraffin 1:20 - 1:50 | |
| EC 2.7.11, EC 2.7.11.1, FLJ39200, KIAA0807RP4-533D7.1, MAST205microtubule associated testis specific serine/threonine protein kinase, microtubule associated serine/threonine kinase 2, microtubule-associated serine/threonine-protein kinase 2, MTSSK | |
| This antibody was developed against Recombinant Protein corresponding to amino acids: LLFRKLSNPDIFSSTGKVKLQRQLSQDDCKLWRGNLASSLSGKQLLPLSSSVHSSVGQVTWQSSGEASNLVRMRNQS | |
| 25 μL | |
| Protein Kinase | |
| 23139 | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. | |
| IgG |
| Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| PBS (pH 7.2) and 40% Glycerol | |
| Rabbit | |
| Immunogen affinity purified | |
| RUO | |
| Primary | |
| Human | |
| Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction