missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Matriptase/ST14 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP3-05520-100ul
This item is not returnable.
View return policy
Description
Matriptase/ST14 Polyclonal antibody specifically detects Matriptase/ST14 in Human samples. It is validated for Immunocytochemistry/ Immunofluorescence
Specifications
| Matriptase/ST14 | |
| Polyclonal | |
| Immunocytochemistry/ Immunofluorescence 0.25-2 μg/mL | |
| EC 3.4.21, HAI, Matriptase, Membrane-type serine protease 1, MT-SP1EC 3.4.21.109, prostamin, PRSS14, Serine protease 14, Serine protease TADG-15, SNC19MTSP1, suppression of tumorigenicity 14 (colon carcinoma), suppression of tumorigenicity 14 (colon carcinoma, matriptase, epithin), suppressor of tumorigenicity 14 protein, TADG15, TMPRSS14, tumor associated differentially expressed gene 15 protein, Tumor-associated differentially-expressed gene 15 protein | |
| This antibody was developed against a recombinant protein corresponding to amino acids: VFNGYMRITNENFVDAYENSNSTEFVSLASKVKDALKLLYSGVPFLGPYHKESAVTAFSEGSVIAYYWSEFSIPQHLVE | |
| 100 μg | |
| Cancer | |
| 6768 | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. | |
| IgG |
| Immunofluorescence | |
| Unconjugated | |
| PBS, pH 7.2, containing 40% glycerol | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| Primary | |
| Human | |
| Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Comparta una corrección de contenido