missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Matriptase/ST14 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
€ 412.00 - € 742.00
Specifications
| Antigen | Matriptase/ST14 |
|---|---|
| Dilution | Immunocytochemistry/ Immunofluorescence 0.25-2 μg/mL |
| Applications | Immunofluorescence |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18682588
|
Novus Biologicals
NBP3-05520-100ul |
100 μg |
€ 742.00
100µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18651858
|
Novus Biologicals
NBP3-05520-25ul |
25 μg |
€ 412.00
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
Matriptase/ST14 Polyclonal antibody specifically detects Matriptase/ST14 in Human samples. It is validated for Immunocytochemistry/ ImmunofluorescenceSpecifications
| Matriptase/ST14 | |
| Immunofluorescence | |
| Unconjugated | |
| Rabbit | |
| Cancer | |
| PBS, pH 7.2, containing 40% glycerol | |
| 6768 | |
| IgG | |
| Affinity purified |
| Immunocytochemistry/ Immunofluorescence 0.25-2 μg/mL | |
| Polyclonal | |
| Purified | |
| RUO | |
| Human | |
| EC 3.4.21, HAI, Matriptase, Membrane-type serine protease 1, MT-SP1EC 3.4.21.109, prostamin, PRSS14, Serine protease 14, Serine protease TADG-15, SNC19MTSP1, suppression of tumorigenicity 14 (colon carcinoma), suppression of tumorigenicity 14 (colon carcinoma, matriptase, epithin), suppressor of tumorigenicity 14 protein, TADG15, TMPRSS14, tumor associated differentially expressed gene 15 protein, Tumor-associated differentially-expressed gene 15 protein | |
| This antibody was developed against a recombinant protein corresponding to amino acids: VFNGYMRITNENFVDAYENSNSTEFVSLASKVKDALKLLYSGVPFLGPYHKESAVTAFSEGSVIAYYWSEFSIPQHLVE | |
| Primary | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title