missing translation for 'onlineSavingsMsg'
Learn More
Learn More
MBOAT1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP1-55258
This item is not returnable.
View return policy
Description
MBOAT1 Polyclonal specifically detects MBOAT1 in Human samples. It is validated for Western Blot.
Specifications
| MBOAT1 | |
| Polyclonal | |
| Unconjugated | |
| PBS, 2% Sucrose with 0.09% Sodium Azide | |
| dJ434O11.1, EC 2.3.1.-, EC 2.3.1.n6,1-acylglycerophosphoserine O-acyltransferase, LPEAT1, LPLAT 1, LPSAT, lysophosphatidylethanolamine acyltransferase 1, Lysophosphatidylserine acyltransferase, lysophospholipid acyltransferase 1, Lyso-PS acyltransferase, membrane bound O-acyltransferase domain containing 1, Membrane-bound O-acyltransferase domain-containing protein 1, MGC44669, OACT1, O-acyltransferase (membrane bound) domain containing 1, O-acyltransferase domain-containing protein 1 | |
| Rabbit | |
| 56 kDa | |
| 100 μL | |
| Primary | |
| Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer. | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
| Western Blot | |
| 0.5 mg/ml | |
| Western Blot 1.0 ug/ml | |
| Q6ZNC8 | |
| MBOAT1 | |
| Synthetic peptides corresponding to MBOAT1(membrane bound O-acyltransferase domain containing 1) The peptide sequence was selected from the N terminal of MBOAT1. Peptide sequence AAEPQPSSLSYRTTGSTYLHPLSELLGIPLDQVNFVVCQLVALFAAFWFR. | |
| Affinity purified | |
| RUO | |
| 154141 | |
| Human, Mouse, Rat, Pig, Equine, Rabbit | |
| IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction