missing translation for 'onlineSavingsMsg'
Learn More
Learn More
MBP Antibody (7D2), DyLight 755, Novus Biologicals™
Mouse Monoclonal Antibody
Brand: Novus Biologicals NBP1-05204IR
This item is not returnable.
View return policy
Description
MBP Monoclonal antibody specifically detects MBP in Human, Mouse, Rat, Porcine, Bovine, Equine samples. It is validated for Western Blot, Immunohistochemistry, Immunofluorescence
Specifications
| MBP | |
| Monoclonal | |
| DyLight 755 | |
| 50mM Sodium Borate | |
| Mouse | |
| Affinity purified | |
| RUO | |
| Primary | |
| Human, Mouse, Rat, Pig, Bovine, Equine | |
| Purified |
| Western Blot, Immunohistochemistry, Immunofluorescence | |
| 7D2 | |
| Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence | |
| MGC99675, Myelin A1 protein, myelin basic protein, Myelin membrane encephalitogenic protein | |
| Purified myelin basic protein isolated from bovine brain, epitope maps to the peptide AEGQRPGFGYGGRASDYKSAHKGFKGVDAQGTLSKIFKLG, amino acids 145-184 of the human 21.5kDa sequence. | |
| 0.1 mL | |
| Hypoxia Signaling, Immune System Diseases, Immunology, Neuroscience, Neurotransmission, Oligodendrocyte Cell Markers, Phospho Specific, Stem Cell Markers | |
| 4155 | |
| Store at 4°C in the dark. | |
| IgG1 |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction