missing translation for 'onlineSavingsMsg'
Learn More
Learn More
MCCC2 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP2-38930
This item is not returnable.
View return policy
Description
MCCC2 Polyclonal specifically detects MCCC2 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.
Specifications
| MCCC2 | |
| Polyclonal | |
| Western Blot 0.04 - 0.4 μg/mL, Immunohistochemistry 1:500 - 1:1000, Immunocytochemistry/Immunofluorescence 0.25-2 μg/mL, Immunohistochemistry-Paraffin 1:500 - 1:1000 | |
| Q9HCC0 | |
| MCCC2 | |
| This antibody was developed against a recombinant protein corresponding to amino acids: LPCIYLVDSGGAYLPRQADVFPDRDHFGRTFYNQAIMSSKNIAQIAVVMGSCTAGGAYVPAMADENIIVRKQGTIFLAGP | |
| 0.1 mL | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| 3-methylcrotonyl-CoA:carbon dioxide ligase subunit beta, MCCase subunit beta, MCCBEC 6.4.1.4, methylcrotonoyl-CoA carboxylase 2 (beta), methylcrotonoyl-Coenzyme A carboxylase 2 (beta), mitochondrial, non-biotin containing subunit of 3-methylcrotonyl-CoA carboxylase | |
| Rabbit | |
| Affinity Purified | |
| RUO | |
| 64087 | |
| Human | |
| IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction