missing translation for 'onlineSavingsMsg'
Learn More
Learn More
MCT2 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
€ 369.00 - € 529.00
Specifications
| Antigen | MCT2 |
|---|---|
| Dilution | Western Blot 0.4 ug/ml, Immunohistochemistry, Immunohistochemistry-Paraffin 1:200 - 1:500 |
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18474422
|
Novus Biologicals
NBP1-87846-25ul |
25 μL |
€ 369.00
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18710574
|
Novus Biologicals
NBP1-87846 |
0.1 mL |
€ 529.00
0.10mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
MCT2 Polyclonal specifically detects MCT2 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
| MCT2 | |
| Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| RUO | |
| Human | |
| MCT 2, MCT2solute carrier family 16 (monocarboxylic acid transporters), member 7, monocarboxylate transporter 2, Solute carrier family 16 member 7, solute carrier family 16, member 7 (monocarboxylic acid transporter 2) | |
| SLC16A7 | |
| IgG | |
| Affinity Purified | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| Western Blot 0.4 ug/ml, Immunohistochemistry, Immunohistochemistry-Paraffin 1:200 - 1:500 | |
| Polyclonal | |
| Rabbit | |
| Lipid and Metabolism | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| 9194 | |
| This antibody was developed against Recombinant Protein corresponding to amino acids:GPNQTTSKSKNKTGKTEDDSSPKKIKTKKSTWEKVNKYLDFS | |
| Primary | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title