missing translation for 'onlineSavingsMsg'
Learn More
Learn More
MDH2 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP1-54649
This item is not returnable.
View return policy
Description
MDH2 Polyclonal antibody specifically detects MDH2 in Human, Rat samples. It is validated for Western Blot.
Specifications
| MDH2 | |
| Polyclonal | |
| Unconjugated | |
| PBS, 2% Sucrose with 0.09% Sodium Azide | |
| EC 1.1.1, EC 1.1.1.37, malate dehydrogenase 2, NAD (mitochondrial), MDH, MGC:3559, mitochondrial, MOR1 | |
| Rabbit | |
| 33 kDa | |
| 100 μL | |
| Signal Transduction | |
| 4191 | |
| Human, Rat, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit, Zebrafish | |
| Purified |
| Western Blot, Immunohistochemistry | |
| 1 mg/ml | |
| Western Blot 1.0 ug/ml | |
| P40926 | |
| MDH2 | |
| Synthetic peptides corresponding to MDH2(malate dehydrogenase 2, NAD (mitochondrial)) The peptide sequence was selected from the C terminal of MDH2 (NP_005909). Peptide sequence TYFSTPLLLGKKGIEKNLGIGKVSSFEEKMISDAIPELKASIKKGEDFVK. | |
| Protein A purified | |
| RUO | |
| Primary | |
| Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 100μL of distilled water. Vortex followed by. | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. | |
| IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction