missing translation for 'onlineSavingsMsg'
Learn More
Learn More
MED26 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
€ 391.65 - € 590.10
Specifications
| Antigen | MED26 |
|---|---|
| Dilution | Immunohistochemistry 1:5000 - 1:10000, Immunohistochemistry-Paraffin 1:5000 - 1:10000 |
| Applications | Immunohistochemistry, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18638366
|
Novus Biologicals
NBP2-62629-25ul |
25 μL |
 € 415.00 € 391.65 / 25µL Save € 23.35 5% Off |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18611598
|
Novus Biologicals
NBP2-62629 |
100 μg |
€ 624.00 € 590.10 / 100µL Save € 33.90 5% Off |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
MED26 Polyclonal antibody specifically detects MED26 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry (Paraffin)Specifications
| MED26 | |
| Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| Rabbit | |
| Human | |
| Activator-recruited cofactor 70 kDa component, Cofactor required for Sp1 transcriptional activation subunit 7, cofactor required for Sp1 transcriptional activation, subunit 7 (70kD), cofactor required for Sp1 transcriptional activation, subunit 7, 70kDa, CRSP70ARC70, CRSP7CRSP complex subunit 7, mediator complex subunit 26Transcriptional coactivator CRSP70, mediator of RNA polymerase II transcription subunit 26 | |
| This antibody was developed against a recombinant protein corresponding to amino acids: PGAHHFMSEYLKQEESTRQGARQLHVLVPQSPPTDLPGLTREVTQDDLDRIQASQWPGVNGCQDTQGNWYDWT | |
| Primary | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
| Immunohistochemistry 1:5000 - 1:10000, Immunohistochemistry-Paraffin 1:5000 - 1:10000 | |
| Polyclonal | |
| Purified | |
| RUO | |
| PBS (pH 7.2) and 40% Glycerol | |
| 9441 | |
| IgG | |
| Protein A purified |
Spot an opportunity for improvement?
Product Title
By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.