missing translation for 'onlineSavingsMsg'
Learn More
Learn More
MED28 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP2-38271-25ul
This item is not returnable.
View return policy
Description
MED28 Polyclonal specifically detects MED28 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.
Specifications
| MED28 | |
| Polyclonal | |
| Immunohistochemistry, Immunohistochemistry-Paraffin 1:50 - 1:200 | |
| Q9H204 | |
| MED28 | |
| This antibody was developed against a recombinant protein corresponding to amino acids: PSSSTLVDELESSFEACFASLVSQDYVNGTDQEEIRTGVDQCIQKFLDIARQTECFFLQKRLQLSVQKPEQV | |
| 25 μL | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
| Store at 4°C short term. Aliquot and store at-20°C long term. Avoid freeze/thaw cycles. |
| Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| DKFZP434N185, EG1DKFZp434N185, magicin, mediator complex subunit 281500003D12Rik, mediator of RNA polymerase II transcription, subunit 28 homolog (S. cerevisiae), subunit 28 homolog | |
| Rabbit | |
| Affinity Purified | |
| RUO | |
| 80306 | |
| Human | |
| IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction