missing translation for 'onlineSavingsMsg'
Learn More
Learn More
MEK2 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
€ 369.00 - € 593.00
Specifications
| Antigen | MEK2 |
|---|---|
| Applications | Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18654346
|
Novus Biologicals
NBP2-38660-25ul |
25 μL |
€ 369.00
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18172398
|
Novus Biologicals
NBP2-38660 |
0.1 mL |
€ 593.00
0.10mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
MEK2 Polyclonal specifically detects MEK2 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.Specifications
| MEK2 | |
| Polyclonal | |
| Rabbit | |
| Angiogenesis, Autophagy, Cancer, MAP Kinase Signaling, Protein Kinase, Protein Phosphatase, Signal Transduction | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| ERK activator kinase 2, MAPKK 2, MEK 2, MEK2EC 2.7.12.2, mitogen-activated protein kinase kinase 2, MKK2FLJ26075, p45, PRKMK2MAPKK2 | |
| MAP2K2 | |
| IgG | |
| Affinity Purified |
| Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| RUO | |
| Human | |
| P36507 | |
| 5605 | |
| This antibody was developed against a recombinant protein corresponding to amino acids: MLARRKPVLPALTINPTIAEGPSPTSEGASEANLVDLQKKLEEL | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title