missing translation for 'onlineSavingsMsg'
Learn More
Learn More
MEK5 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP1-89655-25ul
This item is not returnable.
View return policy
Description
MEK5 Polyclonal specifically detects MEK5 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.
Specifications
| MEK5 | |
| Polyclonal | |
| Western Blot 0.4 ug/ml, Immunohistochemistry 1:200 - 1:500, Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml, Immunohistochemistry-Paraffin 1:200 - 1:500 | |
| HsT17454, MAP kinase kinase 5, MAP kinase kinase MEK5b, MAPK/ERK kinase 5, MAPKK 5, MAPKK5EC 2.7.12.2, MEK5MEK 5, mitogen-activated protein kinase kinase 5, MKK5, PRKMK5dual specificity mitogen-activated protein kinase kinase 5 | |
| Rabbit | |
| Affinity Purified | |
| RUO | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| MAP2K5 | |
| This antibody was developed against Recombinant Protein corresponding to amino acids:LGRFPYPQIQKNQGSLMPLQLLQCIVDEDSPVLPVGEFSEPFVHFITQCMRKQPKERPAPEELMGHPFIVQFNDGNA | |
| 25 μL | |
| Neuroscience, Protein Kinase | |
| 5607 | |
| Human | |
| IgG |
Product Title
By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.
For Research Use Only
Spot an opportunity for improvement?