missing translation for 'onlineSavingsMsg'
Learn More
Learn More
METTL13 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP1-55484
This item is not returnable.
View return policy
Description
METTL13 Polyclonal specifically detects METTL13 in Human samples. It is validated for Western Blot.
Specifications
| METTL13 | |
| Polyclonal | |
| Unconjugated | |
| PBS, 2% Sucrose with 0.09% Sodium Azide | |
| antiapoptotic protein FEAT, CGI-01, EC 2.1.1, EC 2.1.1.-, FLJ10310, KIAA0859feat, methyltransferase like 13, methyltransferase-like protein 13,5630401D24Rik | |
| Rabbit | |
| 60 kDa | |
| 100 μL | |
| Primary | |
| Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 100μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer. | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. | |
| IgG |
| Western Blot | |
| 1 mg/ml | |
| Western Blot 1.0 ug/ml | |
| Q8N6R0-1 | |
| METTL13 | |
| Synthetic peptides corresponding to KIAA0859(KIAA0859) The peptide sequence was selected from the C terminal of KIAA0859. Peptide sequence NEILFCQLHPEQKLATPELLETAQALERTLRKPGRGWDDTYVLSDMLKTV. | |
| Protein A purified | |
| RUO | |
| 51603 | |
| Human, Mouse, Rat, Canine, Equine, Guinea Pig, Rabbit | |
| Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction