missing translation for 'onlineSavingsMsg'
Learn More
Learn More
METTL14 Antibody (CL4252), Novus Biologicals™
Mouse Monoclonal Antibody
€ 369.00 - € 539.00
Specifications
| Antigen | METTL14 |
|---|---|
| Applications | Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) |
| Classification | Monoclonal |
| Conjugate | Unconjugated |
| Form | Purified |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18282562
|
Novus Biologicals
NBP2-59043 |
100 μL |
€ 539.00
100µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18650388
|
Novus Biologicals
NBP2-59043-25ul |
25 μL |
€ 369.00
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
METTL14 Monoclonal specifically detects METTL14 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.Specifications
| METTL14 | |
| Monoclonal | |
| Purified | |
| RUO | |
| Human | |
| 57721 | |
| This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:RSWNMDSRLQEIRERQKLRRQLLAQQLGAESADSIGAVLNSKDEQREIAETRETCRASYDTSAPNAKRKYLDEGETDEDKMEEYKDELEMQQDEE | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| Mouse | |
| Lipid and Metabolism | |
| EC 2.1.1, EC 2.1.1.-, KIAA1627methyltransferase-like protein 14, methyltransferase like 14 | |
| METTL14 | |
| IgG2a | |
| Protein A purified |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title