missing translation for 'onlineSavingsMsg'
Learn More
Learn More
MGMT Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
€ 302.00
Specifications
| Antigen | MGMT |
|---|---|
| Applications | Western Blot, Immunocytochemistry, Immunofluorescence |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
MGMT Polyclonal specifically detects MGMT in Human samples. It is validated for Western Blot, Immunocytochemistry/Immunofluorescence.Specifications
| MGMT | |
| Polyclonal | |
| Rabbit | |
| Apoptosis, Cancer, Chromatin Research, Direct Reversal of DNA Damage, DNA Repair, Tumor Suppressors | |
| 6-O-methylguanine-DNA methyltransferase, EC 2.1.1.63, methylated-DNA--protein-cysteine methyltransferase, methylguanine-DNA methyltransferase, O-6-methylguanine-DNA methyltransferase, O6-methylguanine-DNA methyltransferase, O-6-methylguanine-DNA-alkyltransferase | |
| MGMT | |
| IgG | |
| Affinity Purified |
| Western Blot, Immunocytochemistry, Immunofluorescence | |
| Unconjugated | |
| RUO | |
| Human | |
| 4255 | |
| This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:KDCEMKRTTLDSPLGKLELSGCEQGLHEIKLLGKGTSAADAVEVPAPAAVLGGPEPLMQCTAWLNAYFHQPE | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title