missing translation for 'onlineSavingsMsg'
Learn More
Learn More
MIER3 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Marke: Novus Biologicals NBP2-38080
Dieser Artikel kann nicht zurückgegeben werden.
Rückgaberichtlinie anzeigen
Beschreibung
MIER3 Polyclonal specifically detects MIER3 in Human samples. It is validated for Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.
Spezifikation
| MIER3 | |
| Polyclonal | |
| Immunohistochemistry, Immunocytochemistry/Immunofluorescence 1-4 ug/ml, Immunohistochemistry-Paraffin 1:1000 - 1:2500 | |
| Q7Z3K6 | |
| MIER3 | |
| This antibody was developed against a recombinant protein corresponding to amino acids: VPESFMNEVSVNNLGVDFENHTHHITSAKMAVSVADFGSLSANETNGFISAHALHQHAALHSE | |
| 0.1 mL | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| DKFZp686L09111, DKFZp781G1119, DKFZp781I1119, FLJ35954, mesoderm induction early response 1, family member 3, mesoderm induction early response protein 3, mi-er3 | |
| Rabbit | |
| Affinity Purified | |
| RUO | |
| 166968 | |
| Human | |
| IgG |
Berichtigung von Produktinhalten
Bitte geben Sie uns Ihr Feedback zu den Produktinhalten, indem Sie das folgende Formular ausfüllen.
Name des Produkts
Haben Sie Verbesserungsvorschläge?Übermitteln Sie eine inhaltliche Korrektur