missing translation for 'onlineSavingsMsg'
Learn More
Learn More
MIG2/Kindlin-2 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP1-87884
This item is not returnable.
View return policy
Description
MIG2/Kindlin-2 Polyclonal specifically detects MIG2/Kindlin-2 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.
Specifications
| MIG2/Kindlin-2 | |
| Polyclonal | |
| Unconjugated | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| fermitin family homolog 2, fermitin family homolog 2 (Drosophila), fermitin family member 2, KIND2DKFZp686G11125, kindlin 2, Kindlin-2, mig-2, MIG2FLJ34213, mitogen inducible gene 2 protein, Mitogen-inducible gene 2 protein, PH domain-containing family C member 1, pleckstrin homology domain containing, family C (with FERM domain) member 1, pleckstrin homology domain containing, family C member 1, Pleckstrin homology domain-containing family C member 1, PLEKHC1FLJ44462, UNC112, UNC112B | |
| Rabbit | |
| 78 kDa | |
| 0.1 mL | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) | |
| 0.2mg/mL | |
| Western Blot 0.4 ug/ml, Immunohistochemistry 1:200 - 1:500, Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml, Immunohistochemistry-Paraffin 1:200 - 1:500 | |
| Q96AC1 | |
| FERMT2 | |
| This antibody was developed against Recombinant Protein corresponding to amino acids:MADSSYNLEVQNILSFLKMQHLNPDPQLIPEQITTDITPECLVSPRYLKKYKNKQITARILEA | |
| Affinity Purified | |
| RUO | |
| 10979 | |
| Human | |
| IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction