missing translation for 'onlineSavingsMsg'
Learn More
Learn More
MiRP1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP2-38653
This item is not returnable.
View return policy
Description
MiRP1 Polyclonal specifically detects MiRP1 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.
Specifications
| MiRP1 | |
| Polyclonal | |
| Immunohistochemistry, Immunohistochemistry-Paraffin 1:200 - 1:500 | |
| Q9Y6J6 | |
| KCNE2 | |
| This antibody was developed against a recombinant protein corresponding to amino acids: STVKSKRREHSNDPYHQYIVEDWQEKYKSQILNLEESKATIHENIGAAGFKMS | |
| 0.1 mL | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| ATFB4, cardiac voltage-gated potassium channel accessory subunit 2, human minK-related peptide 1, potassium channel subunit, MiRP110Minimum potassium ion channel-related peptide 1, LQT5, LQT6, MGC138292, MinK-related peptide 1, minK-related peptide-1, MIRP1, Potassium channel subunit beta MiRP1, potassium channel subunit, MiRP1, potassium voltage-gated channel subfamily E member 2, potassium voltage-gated channel, Isk-related family, member 2, voltage-gated K+ channel subunit MIRP1 | |
| Rabbit | |
| Affinity Purified | |
| RUO | |
| 9992 | |
| Human | |
| IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction