missing translation for 'onlineSavingsMsg'
Learn More
Learn More
MKK6/MEK6 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP1-87791
This item is not returnable.
View return policy
Description
MKK6/MEK6 Polyclonal antibody specifically detects MKK6/MEK6 in Human, Mouse, Rat samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/ Immunofluorescence, Immunohistochemistry (Paraffin)
Specifications
| MKK6/MEK6 | |
| Polyclonal | |
| Western Blot 0.04-0.4 ug/mL, Immunohistochemistry 1:200 - 1:500, Immunocytochemistry/ Immunofluorescence 0.25-2 ug/mL, Immunohistochemistry-Paraffin 1:200-1:500 | |
| MAP kinase kinase 6, MAPK/ERK kinase 6, MAPKK6dual specificity mitogen-activated protein kinase kinase 6, MEK6MAPKK 6, mitogen-activated protein kinase kinase 6, MKK6MEK 6, PRKMK6protein kinase, mitogen-activated, kinase 6 (MAP kinase kinase 6), SAPKK3EC 2.7.12.2 | |
| This antibody was developed against Recombinant Protein corresponding to amino acids: SQSKGKKRNPGLKIPKEAFEQPQTSSTPPRDLDSKACISIGNQNFEVKADDLEPIMELGR | |
| 0.1 mL | |
| Angiogenesis, Apoptosis, Cancer, Cell Cycle and Replication, Hypoxia, Protein Kinase | |
| 5608 | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. | |
| IgG |
| Western Blot, Immunohistochemistry, Immunocytochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| PBS (pH 7.2) and 40% Glycerol | |
| Rabbit | |
| Immunogen affinity purified | |
| RUO | |
| Primary | |
| Human, Mouse, Rat | |
| Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction