missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Description
MKP-1/DUSP1 Polyclonal specifically detects MKP-1/DUSP1 in Human samples. It is validated for Western Blot, Immunocytochemistry/Immunofluorescence.
Specifications
Specifications
| Antigen | MKP-1/DUSP1 |
| Applications | Western Blot, Immunocytochemistry, Immunofluorescence |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Dilution | Western Blot 0.04-0.4 μg/mL, Immunocytochemistry/Immunofluorescence 0.25-2 μg/mL |
| Formulation | PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide |
| Gene Alias | CL100MAP kinase phosphatase 1, dual specificity phosphatase 1, Dual specificity protein phosphatase hVH1, EC 3.1.3.16, EC 3.1.3.48, HVH1, Mitogen-activated protein kinase phosphatase 1, MKP1, MKP-1dual specificity protein phosphatase 1, Protein-tyrosine phosphatase CL100, PTPN10serine/threonine specific protein phosphatase, VH1 |
| Gene Symbols | DUSP1 |
| Host Species | Rabbit |
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:QVLAPHCSAEAGSPAMAVLDRGTSTTTVFNFPVSIPVHSTNSALSYLQS |
| Show More |
For Research Use Only
Product Title
By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.
Spot an opportunity for improvement?