missing translation for 'onlineSavingsMsg'
Learn More
Learn More
MMP-8 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
€ 386.00
Specifications
| Antigen | MMP-8 |
|---|---|
| Dilution | Immunohistochemistry 1:50 - 1:200, Immunohistochemistry-Paraffin 1:50 - 1:200 |
| Applications | Immunohistochemistry, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18417771
|
Novus Biologicals
NBP1-85577 |
0.1 mL |
N/A
|
N/A | |||||
|
18465082
|
Novus Biologicals
NBP1-85577-25ul |
25 μL |
€ 386.00
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
MMP-8 Polyclonal antibody specifically detects MMP-8 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry (Paraffin)Specifications
| MMP-8 | |
| Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| Rabbit | |
| Cancer | |
| PBS (pH 7.2) and 40% Glycerol | |
| 4317 | |
| IgG | |
| Immunogen affinity purified |
| Immunohistochemistry 1:50 - 1:200, Immunohistochemistry-Paraffin 1:50 - 1:200 | |
| Polyclonal | |
| Purified | |
| RUO | |
| Human | |
| CLG1HNC, EC 3.4.24, EC 3.4.24.34, matrix metallopeptidase 8 (neutrophil collagenase), matrix metalloproteinase 8 (neutrophil collagenase), Matrix metalloproteinase-8, MMP-8, neutrophil collagenase, PMNL collagenase, PMNL-CL | |
| This antibody was developed against Recombinant Protein corresponding to amino acids: TVQDYLEKFYQLPSNQYQSTRKNGTNVIVEKLKEMQRFFGLNVTGKPNEETLDMMKKPRCGVPDSGG | |
| Primary | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title